PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca007247G01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 253aa    MW: 29278 Da    PI: 8.0653
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca007247G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.92.1e-121461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT eEd +l + +   G  +W+++++  g+ R++k+c++rw +yl
  Gh_Sca007247G01 14 RGQWTIEEDHKLTNFILNNGIICWRKVPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding55.61.2e-1767110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T  E+ ++++++ +lG++ W++Ia++++ gRt++++k++w++
  Gh_Sca007247G01  67 RGSFTDSEEHQIIQLHSRLGNR-WSKIASHFP-GRTDNEIKNHWNT 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-19564IPR009057Homeodomain-like
PROSITE profilePS5129412.829961IPR017930Myb domain
SuperFamilySSF466891.83E-2611108IPR009057Homeodomain-like
SMARTSM007171.3E-61363IPR001005SANT/Myb domain
PfamPF002491.4E-101461IPR001005SANT/Myb domain
CDDcd001678.01E-51761No hitNo description
PROSITE profilePS5129426.36462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2665117IPR009057Homeodomain-like
SMARTSM007171.2E-1566114IPR001005SANT/Myb domain
PfamPF002493.1E-1667110IPR001005SANT/Myb domain
CDDcd001677.63E-1069110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MGRQPCCDKV GLKRGQWTIE EDHKLTNFIL NNGIICWRKV PKLAGLLRCG KSCRLRWINY  60
LRPGLKRGSF TDSEEHQIIQ LHSRLGNRWS KIASHFPGRT DNEIKNHWNT RIKKKLKQLG  120
LDSQKPFEIE KSRKNYGNKN NMNSDSSSSN KQEAISLESR PEDDHGMKIC PKKAERPEEM  180
KATVDETNDP LNNYQMLSGS SDLDWLKESN NVSMGETACV EEEYWVDGVD SFLSWDSFVH  240
VEDKFFPSWE IGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487726.11e-173PREDICTED: myb-related protein 315-like
TrEMBLA0A0D2SFQ31e-173A0A0D2SFQ3_G
STRINGPOPTR_0001s36220.14e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.14e-76myb domain protein 40